Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

LPAR4

DescriptionLysophosphatidic acid receptor 4

Gene and Protein Information

Gene ID2846
Uniprot Accession IDs B2RAC7 O15132 Q502U9 Q6NSP5 LPA receptor 4
Ensembl ID ENSP00000408205
Symbol GPR23 LPA4 P2RY9 LPA4 P2Y9 GPR23 P2RY9 P2Y5-LIKE
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque707170LPAR4lysophosphatidic acid receptor 49544Inparanoid, OMA
Mouse78134Lpar4lysophosphatidic acid receptor 410090MGI:1925384Inparanoid, OMA
Rat302378Lpar4lysophosphatidic acid receptor 410116RGD:1563686Inparanoid, OMA
Dog491978LPAR4lysophosphatidic acid receptor 49615VGNC:42745Inparanoid, OMA
Horse100071749LPAR4lysophosphatidic acid receptor 49796VGNC:19730Inparanoid, OMA
Cow539738LPAR4lysophosphatidic acid receptor 49913VGNC:30958Inparanoid, OMA
Opossum100020275LPAR4lysophosphatidic acid receptor 413616Inparanoid, OMA
Chicken422149LPAR4lysophosphatidic acid receptor 49031CGNC:3024Inparanoid, OMA
Anole lizard100562456lpar4lysophosphatidic acid receptor 428377Inparanoid, OMA
Xenopus780308lpar4lysophosphatidic acid receptor 48364XB-GENE-989373Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Lysophospholipid (LPA) receptor    /    Lysophosphatidic acid receptor 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.