The store will not work correctly when cookies are disabled.
LEP
Gene and Protein Information
| Gene ID | 3952 |
|---|
| Uniprot Accession IDs | O15158 Q56A88 |
|---|
| Ensembl ID | ENSP00000312652 |
|---|
| Symbol | OB OBS OB OBS LEPD |
|---|
| Family | Belongs to the leptin family. |
|---|
| Sequence | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 698728 | LEP | leptin | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16846 | Lep | leptin | 10090 | MGI:104663 | Inparanoid, OMA, EggNOG |
| Rat | 25608 | Lep | leptin | 10116 | RGD:3000 | Inparanoid, OMA, EggNOG |
| Dog | 403616 | LEP | leptin | 9615 | VGNC:42637 | Inparanoid, OMA, EggNOG |
| Horse | 100034042 | LEP | leptin | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 280836 | LEP | leptin | 9913 | VGNC:30842 | OMA, EggNOG |
| Opossum | 100014695 | LEP | leptin | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100078019 | LEP | leptin | 9258 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
