Protein or Target Summary
Catechol O-methyltransferase domain-containing protein 1
| Gene ID | 118881 |
|---|---|
| uniprot | Q86VU5 |
| Gene Name | COMTD1 |
| Ensernbl ID | ENSP00000361616 |
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family. |
| Sequence | MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 118881 | COMTD1 | Catechol O-methyltransferase domain-containing protein 1 | Q86VU5 |
| MOUSE | 69156 | Comtd1 | Catechol O-methyltransferase domain-containing protein 1 | Q8BIG7 |
| MOUSE | Comtd1 | Catechol O-methyltransferase domain-containing protein 1 | H3BJ37 | |
| RAT | 305685 | Comtd1 | Catechol-O-methyltransferase domain containing 1 (Predicted), isoform CRA_a | D3ZM21 |
Protein Classes
PANTHER Classes
protein / transferase / methyltransferase / Catechol O-methyltransferase domain-containing protein 1
protein / transferase / methyltransferase / Catechol O-methyltransferase domain-containing protein 1
DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Catechol O-methyltransferase domain-containing protein 1
protein / Enzyme / Transferase / Methyltransferase / Catechol O-methyltransferase domain-containing protein 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx