The store will not work correctly when cookies are disabled.
EBPL
| Description | Emopamil-binding protein-like |
|---|
Gene and Protein Information
| Gene ID | 84650 |
|---|
| Uniprot Accession IDs | A6NJ59 Q569H7 Q5JVN2 Q5JVN3 Q5JVN4 Q5JVN5 Q5JVN6 |
|---|
| Ensembl ID | ENSP00000242827 |
|---|
| Symbol | EBRP ERP EBRP |
|---|
| Family | Belongs to the EBP family. |
|---|
| Sequence | MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452721 | EBPL | emopamil binding protein like | 9598 | VGNC:7286 | OMA, EggNOG |
| Macaque | 706833 | EBPL | emopamil binding protein like | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 68177 | Ebpl | emopamil binding protein-like | 10090 | MGI:1915427 | Inparanoid, OMA, EggNOG |
| Rat | 361054 | Ebpl | emopamil binding protein-like | 10116 | RGD:1304571 | Inparanoid, OMA, EggNOG |
| Dog | 476910 | EBPL | EBP like | 9615 | VGNC:40179 | Inparanoid, OMA, EggNOG |
| Horse | 100629436 | EBPL | EBP like | 9796 | VGNC:17399 | Inparanoid, OMA, EggNOG |
| Cow | 512958 | EBPL | EBP like | 9913 | VGNC:28300 | Inparanoid, OMA, EggNOG |
| Pig | 100516290 | EBPL | emopamil binding protein like | 9823 | | OMA, EggNOG |
| Opossum | 100028586 | EBPL | emopamil binding protein like | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100490482 | ebpl | emopamil binding protein-like | 8364 | XB-GENE-1003344 | Inparanoid, OMA, EggNOG |
| Zebrafish | 768138 | ebpl | emopamil binding protein-like | 7955 | ZDB-GENE-030616-542 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
isomerase / Emopamil-binding protein-like
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
