JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Leukotriene C4 synthase

Gene ID	4056
uniprot	Q16873
Gene Name	LTC4S
Ensernbl ID	ENSP00000292596
Family	Belongs to the MAPEG family.
Sequence	MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4056	LTC4S	Leukotriene C4 synthase	Q16873
MOUSE		Ltc4s	Leukotriene C4 synthase	A0A1Y7VLL2
MOUSE		Ltc4s	Leukotriene C4 synthase	Q5SVR6
MOUSE	17001	Ltc4s	Leukotriene C4 synthase	Q8K355
MOUSE	17001	Ltc4s	Leukotriene C4 synthase	Q60860
RAT	114097	Ltc4s	Leukotriene C4 synthase	G3V6E6
RAT	114097	Ltc4s	Leukotriene C4 synthase	Q925U2

Protein Classes

PANTHER Classes
protein / transferase / Leukotriene C4 synthase

DTO Classes
protein / Enzyme / Transferase / Leukotriene C4 synthase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx