The store will not work correctly when cookies are disabled.
Protein or Target Summary
Acyl-protein thioesterase 2
| Gene ID | 11313 |
|---|
| uniprot | O95372 |
|---|
| Gene Name | LYPLA2 |
|---|
| Ensernbl ID | ENSP00000363638 |
|---|
| Family | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. |
|---|
| Sequence | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 11313 | LYPLA2 | Acyl-protein thioesterase 2 | O95372 |
| MOUSE | 26394 | Lypla2 | Acyl-protein thioesterase 2 | Q9WTL7 |
| RAT | 83510 | Lypla2 | Acyl-protein thioesterase 2 | Q9QYL8 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
