The store will not work correctly when cookies are disabled.
MT-CO2
| Description | Cytochrome c oxidase subunit 2 |
|---|
Gene and Protein Information
| Gene ID | 4513 |
|---|
| Uniprot Accession IDs | Q37526 |
|---|
| Ensembl ID | ENSP00000354876 |
|---|
| Symbol | COII COX2 COXII MTCO2 COII MTCO2 |
|---|
| Family | Belongs to the cytochrome c oxidase subunit 2 family. |
|---|
| Sequence | MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 807864 | MT-CO2 | mitochondrially encoded cytochrome c oxidase II | 9598 | VGNC:11715 | Inparanoid, OMA, EggNOG |
| Macaque | 2846628 | COX2 | cytochrome c oxidase subunit II | 9544 | | OMA, EggNOG |
| Mouse | 17709 | mt-Co2 | mitochondrially encoded cytochrome c oxidase II | 10090 | MGI:102503 | Inparanoid, OMA, EggNOG |
| Rat | 26198 | Mt-co2 | mitochondrially encoded cytochrome c oxidase II | 10116 | RGD:621872 | Inparanoid, OMA, EggNOG |
| Dog | 804479 | MT-CO2 | mitochondrially encoded cytochrome c oxidase II | 9615 | VGNC:53137 | Inparanoid, OMA, EggNOG |
| Horse | 807845 | COX2 | cytochrome c oxidase subunit II | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 3283880 | COX2 | cytochrome c oxidase subunit II | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 808504 | COX2 | cytochrome c oxidase subunit II | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 3074663 | COX2 | cytochrome c oxidase subunit II | 13616 | | OMA, EggNOG |
| Platypus | 808709 | COX2 | cytochrome c oxidase subunit II | 9258 | | Inparanoid, EggNOG |
| Anole lizard | 6385975 | COX2 | cytochrome c oxidase subunit II | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 3283495 | COX2 | cytochrome c oxidase subunit II | 8364 | | Inparanoid, OMA |
| Zebrafish | 140540 | mt-co2 | cytochrome c oxidase II, mitochondrial | 7955 | ZDB-GENE-011205-15 | Inparanoid, OMA, EggNOG |
| C. elegans | 2565697 | COX2 | cytochrome c oxidase subunit II | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 19893535 | COX2 | cytochrome c oxidase subunit II | 7227 | FBgn0013675 | Inparanoid, EggNOG |
| S.cerevisiae | 854622 | COX2 | cytochrome c oxidase subunit 2 | 4932 | S000007281 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
oxidoreductase / Cytochrome c oxidase subunit 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
