Description | L-selectin |
---|
Gene ID | 6402 |
---|---|
Uniprot Accession IDs | A0A024R8Z0 B2R6Q8 P15023 Q9UJ43 |
Ensembl ID | ENSP00000236147 |
Symbol | LNHR LYAM1 TQ1 LAM1 LEU8 LNHR LSEL CD62L LYAM1 PLNHR LECAM1 |
Family | Belongs to the selectin/LECAM family. |
Sequence | MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY Show more |
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 450191 | SELL | selectin L | 9598 | VGNC:10991 | Inparanoid, OMA, EggNOG |
Macaque | 701419 | SELL | selectin L | 9544 | Inparanoid, OMA, EggNOG | |
Mouse | 20343 | Sell | selectin, lymphocyte | 10090 | MGI:98279 | Inparanoid, OMA, EggNOG |
Rat | 29259 | Sell | selectin L | 10116 | RGD:3655 | Inparanoid, OMA, EggNOG |
Dog | 480080 | SELL | selectin L | 9615 | Inparanoid, OMA, EggNOG | |
Cow | 281485 | SELL | selectin L | 9913 | Inparanoid, OMA | |
Pig | 100127147 | SELL | selectin L | 9823 | Inparanoid, OMA | |
Opossum | 100019469 | SELL | selectin L | 13616 | Inparanoid, OMA | |
Platypus | SELL | selectin L [Source:HGNC Symbol;Acc:HGNC:10720] | 9258 | OMA, EggNOG |
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|---|---|---|---|---|
CD62L Mouse mAb | Human |
Out of Stock
| Expand⌵ | ||
CD62L Rat mAb | Mouse |
In stock
| Expand⌵ | ||
CD62L Mouse mAb (Biotin) | Human |
Out of Stock
| Expand⌵ | ||
CD62L Mouse mAb (FITC) | Human |
Out of Stock
| Expand⌵ | ||
CD62L Mouse mAb (PE) | Human |
Out of Stock
| Expand⌵ | ||
CD62L Mouse mAb (APC) | Human |
Out of Stock
| Expand⌵ | ||
CD62L Rat mAb (Biotin) | Mouse |
Out of Stock
| Expand⌵ | ||
CD62L Rat mAb (PE) | Mouse |
Out of Stock
| Expand⌵ | ||
CD62L Rat mAb (APC) | Mouse |
Out of Stock
| Expand⌵ |
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
1.Dwir, O O, Kansas, G S GS and Alon, R R. 2000-06-23 An activated L-selectin mutant with conserved equilibrium binding properties but enhanced ligand recognition under shear flow. [PMID:10747985] |
2.Walther, A A, Riehemann, K K and Gerke, V V. 2000-05 A novel ligand of the formyl peptide receptor: annexin I regulates neutrophil extravasation by interacting with the FPR. [PMID:10882119] |
3.Kretowski, A A and Kinalska, I I. 2000-11-01 L-selectin gene T668C mutation in type 1 diabetes patients and their first degree relatives. [PMID:11064106] |
4.Matala, E E, Alexander, S R SR, Kishimoto, T K TK and Walcheck, B B. 2001-08-01 The cytoplasmic domain of L-selectin participates in regulating L-selectin endoproteolysis. [PMID:11466384] |
5.Takei, Takashi T and 21 more authors. 2002-03 Association between single-nucleotide polymorphisms in selectin genes and immunoglobulin A nephropathy. [PMID:11828340] |
6.Dwir, Oren O and 6 more authors. 2002-06-14 L-selectin dimerization enhances tether formation to properly spaced ligand. [PMID:11907045] |
7.Korz, Christian C and 8 more authors. 2002-06-15 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes. [PMID:12036888] |
8. and Nicholson, I C IC.CD62L (L-selectin). [PMID:12144128] |
9.Gómez-Gaviro, María Victoria MV and 6 more authors. 2002-10-11 Structure-function relationship and role of tumor necrosis factor-alpha-converting enzyme in the down-regulation of L-selectin by non-steroidal anti-inflammatory drugs. [PMID:12147693] |
10.Jutila, Mark A MA, Kurk, Sandy S, Jackiw, Larrisa L, Knibbs, Randall N RN and Stoolman, Lloyd M LM. 2002-08-15 L-selectin serves as an E-selectin ligand on cultured human T lymphoblasts. [PMID:12165498] |