Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SELL

DescriptionL-selectin

Gene and Protein Information

Gene ID6402
Uniprot Accession IDs A0A024R8Z0 B2R6Q8 P15023 Q9UJ43
Ensembl ID ENSP00000236147
Symbol LNHR LYAM1 TQ1 LAM1 LEU8 LNHR LSEL CD62L LYAM1 PLNHR LECAM1
FamilyBelongs to the selectin/LECAM family.
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp450191SELLselectin L9598VGNC:10991Inparanoid, OMA, EggNOG
Macaque701419SELLselectin L9544Inparanoid, OMA, EggNOG
Mouse20343Sellselectin, lymphocyte10090MGI:98279Inparanoid, OMA, EggNOG
Rat29259Sellselectin L10116RGD:3655Inparanoid, OMA, EggNOG
Dog480080SELLselectin L9615Inparanoid, OMA, EggNOG
Cow281485SELLselectin L9913Inparanoid, OMA
Pig100127147SELLselectin L9823Inparanoid, OMA
Opossum100019469SELLselectin L13616Inparanoid, OMA
PlatypusSELLselectin L [Source:HGNC Symbol;Acc:HGNC:10720]9258OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Dwir, O O, Kansas, G S GS and Alon, R R. 2000-06-23 An activated L-selectin mutant with conserved equilibrium binding properties but enhanced ligand recognition under shear flow. [PMID:10747985]
      2.Walther, A A, Riehemann, K K and Gerke, V V. 2000-05 A novel ligand of the formyl peptide receptor: annexin I regulates neutrophil extravasation by interacting with the FPR. [PMID:10882119]
      3.Kretowski, A A and Kinalska, I I. 2000-11-01 L-selectin gene T668C mutation in type 1 diabetes patients and their first degree relatives. [PMID:11064106]
      4.Matala, E E, Alexander, S R SR, Kishimoto, T K TK and Walcheck, B B. 2001-08-01 The cytoplasmic domain of L-selectin participates in regulating L-selectin endoproteolysis. [PMID:11466384]
      5.Takei, Takashi T and 21 more authors. 2002-03 Association between single-nucleotide polymorphisms in selectin genes and immunoglobulin A nephropathy. [PMID:11828340]
      6.Dwir, Oren O and 6 more authors. 2002-06-14 L-selectin dimerization enhances tether formation to properly spaced ligand. [PMID:11907045]
      7.Korz, Christian C and 8 more authors. 2002-06-15 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes. [PMID:12036888]
      8. and Nicholson, I C IC.CD62L (L-selectin). [PMID:12144128]
      9.Gómez-Gaviro, María Victoria MV and 6 more authors. 2002-10-11 Structure-function relationship and role of tumor necrosis factor-alpha-converting enzyme in the down-regulation of L-selectin by non-steroidal anti-inflammatory drugs. [PMID:12147693]
      10.Jutila, Mark A MA, Kurk, Sandy S, Jackiw, Larrisa L, Knibbs, Randall N RN and Stoolman, Lloyd M LM. 2002-08-15 L-selectin serves as an E-selectin ligand on cultured human T lymphoblasts. [PMID:12165498]