JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

L-selectin

Gene ID	6402
uniprot	P14151
Gene Name	SELL
Ensernbl ID	ENSP00000236147
Family	Belongs to the selectin/LECAM family.
Sequence	MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	6402	SELL	L-selectin	P14151
MOUSE	20343	Sell	L-selectin	B1B506
MOUSE		Sell	L-selectin	A0A0A6YW25
MOUSE		Sell	L-selectin	Q3TSW6
MOUSE		Sell	Uncharacterized protein	Q3TR50
MOUSE		Sell	L-selectin	Q3TA36
MOUSE	20343	Sell	L-selectin	Q3UV83
MOUSE	20343	Sell	L-selectin	Q3TCF3
MOUSE	20343	Sell	L-selectin	B1B507
MOUSE	20343	Sell	L-selectin	P18337
RAT	29259	Sell	L-selectin	Q63762
RAT		Sell	L-selectin	F7EY63
RAT		Sell	L-selectin	P30836

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx