The store will not work correctly when cookies are disabled.
GSTZ1
| Description | Maleylacetoacetate isomerase |
|---|
Gene and Protein Information
| Gene ID | 2954 |
|---|
| Uniprot Accession IDs | A6NED0 A6NNB8 A8MWD7 B2RCK3 O15308 O75430 Q6IB17 Q7Z610 Q9BV63 MAAI |
|---|
| Ensembl ID | ENSP00000216465 |
|---|
| Symbol | MAAI MAI MAAI MAAID GSTZ1-1 |
|---|
| Family | Belongs to the GST superfamily. Zeta family. |
|---|
| Sequence | MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 453068 | GSTZ1 | glutathione S-transferase zeta 1 | 9598 | VGNC:12663 | OMA, EggNOG |
| Macaque | 705723 | GSTZ1 | glutathione S-transferase zeta 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14874 | Gstz1 | glutathione transferase zeta 1 (maleylacetoacetate isomerase) | 10090 | MGI:1341859 | Inparanoid, OMA, EggNOG |
| Rat | 681913 | Gstz1 | glutathione S-transferase zeta 1 | 10116 | RGD:1589363 | Inparanoid, OMA, EggNOG |
| Dog | 490806 | GSTZ1 | glutathione S-transferase zeta 1 | 9615 | VGNC:41537 | Inparanoid, OMA, EggNOG |
| Horse | 100052190 | GSTZ1 | glutathione S-transferase zeta 1 | 9796 | VGNC:18630 | Inparanoid, OMA, EggNOG |
| Cow | 514822 | GSTZ1 | glutathione S-transferase zeta 1 | 9913 | VGNC:29688 | Inparanoid, OMA, EggNOG |
| Pig | 100626791 | GSTZ1 | glutathione S-transferase zeta 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017470 | GSTZ1 | glutathione S-transferase zeta 1 | 13616 | | Inparanoid, EggNOG |
| Platypus | 100077359 | GSTZ1 | glutathione S-transferase zeta 1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 423374 | GSTZ1 | glutathione S-transferase zeta 1 | 9031 | CGNC:7940 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555243 | gstz1 | glutathione S-transferase zeta 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100145591 | gstz1 | glutathione S-transferase zeta 1 | 8364 | XB-GENE-978910 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436754 | gstz1 | glutathione S-transferase zeta 1 | 7955 | ZDB-GENE-040718-184 | Inparanoid, OMA |
| C. elegans | 190243 | Y53G8B.1 | hypothetical protein | 6239 | | OMA, EggNOG |
| Fruitfly | 41132 | GstZ1 | Glutathione S transferase Z1 | 7227 | FBgn0037696 | OMA, EggNOG |
| Fruitfly | 41133 | GstZ2 | Glutathione S transferase Z2 | 7227 | FBgn0037697 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
