The store will not work correctly when cookies are disabled.
LMO7DN
| Description | LMO7 downstream neighbor protein |
|---|
Gene and Protein Information
| Gene ID | 729420 |
|---|
| Uniprot Accession IDs | Q8NAG9 |
|---|
| Ensembl ID | ENSP00000317235 |
|---|
| Symbol | C13orf45 C13orf45 |
|---|
| Sequence | MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736687 | LMO7DN | LMO7 downstream neighbor | 9598 | VGNC:13164 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
