The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
LMO7DN
| Description | LMO7 downstream neighbor protein |
|---|
Gene and Protein Information
| Gene ID | 729420 |
|---|
| Uniprot Accession IDs | F2Z398 Q8NAG9 |
|---|
| Ensembl ID | ENSP00000317235 |
|---|
| Symbol | C13orf45 C13orf45 |
|---|
| Sequence | MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736687 | LMO7DN | LMO7 downstream neighbor | 9598 | VGNC:13164 | OMA, EggNOG |
Associated Recombinant Proteins
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Bibliography
The page will load shortly, Thanks for your patience!
