The store will not work correctly when cookies are disabled.
MMP16
| Description | Matrix metalloproteinase-16 |
|---|
Gene and Protein Information
| Gene ID | 4325 |
|---|
| Uniprot Accession IDs | B2RAN7 Q14824 Q52H48 MMP-16 |
|---|
| Ensembl ID | ENSP00000286614 |
|---|
| Symbol | C8orf57 MMPX2 MMP-X2 C8orf57 MT-MMP2 MT-MMP3 MT3-MMP |
|---|
| Family | Belongs to the peptidase M10A family. |
|---|
| Sequence | MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736322 | MMP16 | matrix metallopeptidase 16 | 9598 | VGNC:6570 | OMA, EggNOG |
| Macaque | 695120 | MMP16 | matrix metallopeptidase 16 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 17389 | Mmp16 | matrix metallopeptidase 16 | 10090 | MGI:1276107 | Inparanoid, OMA, EggNOG |
| Rat | 65205 | Mmp16 | matrix metallopeptidase 16 | 10116 | RGD:620199 | Inparanoid, OMA, EggNOG |
| Dog | 487036 | MMP16 | matrix metallopeptidase 16 | 9615 | VGNC:43278 | Inparanoid, OMA |
| Horse | 100049862 | MMP16 | matrix metallopeptidase 16 | 9796 | VGNC:20226 | Inparanoid, OMA, EggNOG |
| Cow | 282886 | MMP16 | matrix metallopeptidase 16 | 9913 | VGNC:31521 | Inparanoid, OMA, EggNOG |
| Pig | 100153257 | MMP16 | matrix metallopeptidase 16 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100021706 | MMP16 | matrix metallopeptidase 16 | 13616 | | Inparanoid, OMA |
| Platypus | 100075102 | MMP16 | matrix metallopeptidase 16 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551730 | mmp16 | matrix metallopeptidase 16 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548746 | mmp16 | matrix metallopeptidase 16 | 8364 | XB-GENE-1007177 | Inparanoid, OMA |
| Zebrafish | 572034 | mmp16b | matrix metallopeptidase 16b (membrane-inserted) | 7955 | ZDB-GENE-061009-22 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
