JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Lymphoid enhancer-binding factor 1

Gene ID	51176
uniprot	Q9UJU2
Gene Name	LEF1
Ensernbl ID	ENSP00000265165
Family	Belongs to the TCF/LEF family.
Sequence	MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	51176	LEF1	Lymphoid enhancer-binding factor 1	Q9UJU2
MOUSE		Lef1	Uncharacterized protein	Q3TEN5
MOUSE	16842	Lef1	Lymphoid enhancer binding factor 1, isoform CRA_d	D3Z654
MOUSE	16842	Lef1	Lymphoid enhancer binding factor 1, isoform CRA_b	Q8C402
MOUSE	16842	Lef1	Lef1 protein	Q8BGZ9
MOUSE	16842	Lef1	Lymphoid enhancer binding factor 1, isoform CRA_a	Q3TYB0
MOUSE	16842	Lef1	Lymphoid enhancer-binding factor 1	P27782
RAT	161452	Lef1	Lymphoid enhancer binding factor 1, isoform CRA_a	G3V7C1
RAT		Lef1	Lymphoid enhancer binding factor 1 short isoform	A5A1E7
RAT	161452	Lef1	Lymphoid enhancer-binding factor 1	Q9QXN1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx