Protein or Target Summary
Lysophosphatidic acid receptor 6
| Gene ID | 10161 |
|---|---|
| uniprot | P43657 |
| Gene Name | LPAR6 |
| Ensernbl ID | ENSP00000367691 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Lysophospholipid (LPA) receptor / Lysophosphatidic acid receptor 6
protein / G-protein coupled receptor / Class A rhodopsin like / Lysophospholipid (LPA) receptor / Lysophosphatidic acid receptor 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx