The store will not work correctly when cookies are disabled.
CMC1
| Description | COX assembly mitochondrial protein homolog |
|---|
Gene and Protein Information
| Gene ID | 152100 |
|---|
| Uniprot Accession IDs | Q68DJ7 Cmc1p |
|---|
| Ensembl ID | ENSP00000418348 |
|---|
| Symbol | C3orf68 C3orf68 |
|---|
| Family | Belongs to the CMC family. |
|---|
| Sequence | MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460238 | CMC1 | C-X9-C motif containing 1 | 9598 | VGNC:9667 | OMA, EggNOG |
| Mouse | 67899 | Cmc1 | COX assembly mitochondrial protein 1 | 10090 | MGI:1915149 | Inparanoid, OMA, EggNOG |
| Rat | 363162 | Cmc1 | C-x(9)-C motif containing 1 | 10116 | RGD:1305283 | Inparanoid, OMA, EggNOG |
| Dog | 485633 | CMC1 | C-X9-C motif containing 1 | 9615 | VGNC:39377 | Inparanoid, OMA, EggNOG |
| Horse | | CMC1 | C-X9-C motif containing 1 [Source:HGNC Symbol;Acc:HGNC:28783] | 9796 | | OMA, EggNOG |
| Cow | 767824 | CMC1 | C-X9-C motif containing 1 | 9913 | VGNC:27478 | Inparanoid, OMA, EggNOG |
| Opossum | 100031844 | CMC1 | C-X9-C motif containing 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 420659 | CMC1 | C-X9-C motif containing 1 | 9031 | CGNC:51311 | Inparanoid, OMA |
| Anole lizard | 100567181 | cmc1 | C-X9-C motif containing 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100135408 | cmc1 | C-x(9)-C motif containing 1 | 8364 | XB-GENE-971040 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406630 | cmc1 | C-x(9)-C motif containing 1 | 7955 | ZDB-GENE-040426-2626 | Inparanoid, OMA |
| Fruitfly | 34998 | CG17996 | CG17996 gene product from transcript CG17996-RA | 7227 | FBgn0032595 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
