The store will not work correctly when cookies are disabled.
LSP1
Description | Lymphocyte-specific protein 1 |
---|
Gene and Protein Information
Gene ID | 4046 |
Uniprot Accession IDs | B3KPP1 B3KRR6 E9PBV6 E9PFP3 Q16096 Q53H48 Q6FHM3 Q9BUY8 |
Ensembl ID | ENSP00000371194 |
Symbol | WP34 WP34 pp52 |
Sequence | MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Mouse | 16985 | Lsp1 | lymphocyte specific 1 | 10090 | MGI:96832 | Inparanoid, OMA, EggNOG |
Rat | 361680 | Lsp1 | lymphocyte-specific protein 1 | 10116 | RGD:1306133 | Inparanoid, OMA, EggNOG |
Dog | 611553 | LSP1 | lymphocyte specific protein 1 | 9615 | VGNC:42849 | Inparanoid, OMA, EggNOG |
Cow | 508832 | LSP1 | lymphocyte specific protein 1 | 9913 | VGNC:31063 | Inparanoid, OMA, EggNOG |
Chicken | 374254 | LSP1 | lymphocyte-specific protein 1 | 9031 | CGNC:4964 | Inparanoid, OMA, EggNOG |
Anole lizard | 100561739 | lsp1 | lymphocyte-specific protein 1 | 28377 | | OMA, EggNOG |
Xenopus | 496868 | lsp1 | lymphocyte-specific protein 1 | 8364 | XB-GENE-490855 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|