Protein or Target Summary

Serine/threonine-protein kinase Nek7

Gene ID	140609
uniprot	Q8TDX7
Gene Name	NEK7
Ensernbl ID	ENSP00000356355
Family	Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
Sequence	MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	140609	NEK7	Serine/threonine-protein kinase Nek7	Q8TDX7
MOUSE	59125	Nek7	Serine/threonine-protein kinase Nek7	Q3TN15
MOUSE	59125	Nek7	Serine/threonine-protein kinase Nek7	Q9ES74
RAT		Nek7	Serine/threonine-protein kinase Nek7	A0A0G2JUP0
RAT	360850	Nek7	Serine/threonine-protein kinase Nek7	D3ZBE5

Protein Classes

PANTHER Classes
protein    /    protein kinase    /    Serine/threonine-protein kinase nek7
protein    /    transferase    /    Serine/threonine-protein kinase nek7
protein    /    kinase    /    Serine/threonine-protein kinase nek7

DTO Classes
protein / Kinase / Protein kinase / Other group / NEK family / Serine/threonine-protein kinase nek7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx