Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Malate dehydrogenase, cytoplasmic

Gene ID4190
uniprotP40925
Gene NameMDH1
Ensernbl IDENSP00000438144
FamilyBelongs to the LDH/MDH superfamily. MDH type 2 family.
Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN4190MDH1Malate dehydrogenase, cytoplasmicP40925
MOUSEMdh1Malate dehydrogenase, cytoplasmicB1ATQ3
MOUSE17449Mdh1Malate dehydrogenase, cytoplasmicP14152
RAT24551Mdh1Malate dehydrogenase, cytoplasmicO88989

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Malate dehydrogenase, cytoplasmic
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Malate dehydrogenase, cytoplasmic

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.