The store will not work correctly when cookies are disabled.
GLO1
| Description | Lactoylglutathione lyase |
|---|
Gene and Protein Information
| Gene ID | 2739 |
|---|
| Uniprot Accession IDs | B2R6P7 B4DDV0 P78375 Q59EL0 Q5TZW3 Q96FC0 Q96J41 |
|---|
| Ensembl ID | ENSP00000362463 |
|---|
| Symbol | GLYI GLOD1 HEL-S-74 |
|---|
| Family | Belongs to the glyoxalase I family. |
|---|
| Sequence | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 748215 | GLO1 | glyoxalase I | 9598 | VGNC:2843 | OMA, EggNOG |
| Mouse | 109801 | Glo1 | glyoxalase 1 | 10090 | MGI:95742 | Inparanoid, OMA, EggNOG |
| Rat | 294320 | Glo1 | glyoxalase 1 | 10116 | RGD:2702 | Inparanoid, OMA, EggNOG |
| Dog | 474894 | GLO1 | glyoxalase I | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100065189 | GLO1 | glyoxalase I | 9796 | VGNC:49457 | Inparanoid, OMA, EggNOG |
| Cow | 540335 | GLO1 | glyoxalase I | 9913 | VGNC:50185 | Inparanoid, OMA, EggNOG |
| Pig | 100156085 | GLO1 | glyoxalase I | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100029700 | GLO1 | glyoxalase I | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100076218 | GLO1 | glyoxalase I | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 421428 | GLO1 | glyoxalase I | 9031 | CGNC:7697 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567895 | glo1 | glyoxalase I | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 594942 | glo1 | glyoxalase 1 | 8364 | XB-GENE-995333 | Inparanoid, OMA |
| Zebrafish | 368213 | glo1 | glyoxalase 1 | 7955 | ZDB-GENE-030722-9 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
