The store will not work correctly when cookies are disabled.
Protein or Target Summary
Lysophospholipase-like protein 1
| Gene ID | 127018 |
|---|
| uniprot | Q5VWZ2 |
|---|
| Gene Name | LYPLAL1 |
|---|
| Ensernbl ID | ENSP00000355895 |
|---|
| Family | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. |
|---|
| Sequence | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 127018 | LYPLAL1 | Lysophospholipase-like protein 1 | Q5VWZ2 |
| MOUSE | 226791 | Lyplal1 | Lysophospholipase-like protein 1 | E9QLB2 |
| MOUSE | 226791 | Lyplal1 | Lysophospholipase-like protein 1 | Q3UFF7 |
| RAT | | Lyplal1 | Lyplal1 protein | B2RYW5 |
| RAT | | Lyplal1 | Lysophospholipase-like 1 | D3ZFS7 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
