The store will not work correctly when cookies are disabled.
Protein or Target Summary
Acyl-protein thioesterase 1
| Gene ID | 10434 |
|---|
| uniprot | O75608 |
|---|
| Gene Name | LYPLA1 |
|---|
| Ensernbl ID | ENSP00000320043 |
|---|
| Family | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. |
|---|
| Sequence | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10434 | LYPLA1 | Acyl-protein thioesterase 1 | O75608 |
| MOUSE | | Lypla1 | Acyl-protein thioesterase 1 | D3Z269 |
| MOUSE | | Lypla1 | Acyl-protein thioesterase 1 | D3Z111 |
| MOUSE | | Lypla1 | Acyl-protein thioesterase 1 | J3QQ63 |
| MOUSE | | Lypla1 | Acyl-protein thioesterase 1 | D3YUG4 |
| MOUSE | | Lypla1 | Acyl-protein thioesterase 1 | J3QP56 |
| MOUSE | 18777 | Lypla1 | Acyl-protein thioesterase 1 | P97823 |
| RAT | 25514 | Lypla1 | Acyl-protein thioesterase 1 | P70470 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
