Protein or Target Summary
D-dopachrome decarboxylase
| Gene ID | 1652 |
|---|---|
| uniprot | P30046 |
| Gene Name | DDT |
| Ensernbl ID | ENSP00000381386 |
| Family | Belongs to the MIF family. |
| Sequence | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1652 | DDT | D-dopachrome decarboxylase | P30046 |
| MOUSE | 13202 | Ddt | D-dopachrome decarboxylase | O35215 |
| MOUSE | Ddt | D-dopachrome decarboxylase | G3UZN1 | |
| MOUSE | 13202 | Ddt | D-dopachrome tautomerase | Q3UNI8 |
| RAT | 29318 | Ddt | D-dopachrome decarboxylase | P80254 |
| RAT | 29318 | Ddt | D-dopachrome tautomerase, isoform CRA_a | A0A0F7RQJ6 |
| RAT | Ddt | D-dopachrome decarboxylase | A0A1W2Q637 |
Protein Classes
PANTHER Classes
protein / signaling molecule / cytokine / D-dopachrome decarboxylase
protein / signaling molecule / isomerase / D-dopachrome decarboxylase
protein / signaling molecule / cytokine / D-dopachrome decarboxylase
protein / signaling molecule / isomerase / D-dopachrome decarboxylase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx