The store will not work correctly when cookies are disabled.
MBD2
| Description | Methyl-CpG-binding domain protein 2 |
|---|
Gene and Protein Information
| Gene ID | 8932 |
|---|
| Uniprot Accession IDs | O95242 Q9UIS8 |
|---|
| Ensembl ID | ENSP00000256429 |
|---|
| Symbol | DMTase NY-CO-41 |
|---|
| Sequence | MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 693801 | MBD2 | methyl-CpG binding domain protein 2 | 9544 | | Inparanoid, OMA |
| Mouse | 17191 | Mbd2 | methyl-CpG binding domain protein 2 | 10090 | MGI:1333813 | Inparanoid, OMA, EggNOG |
| Rat | 680172 | Mbd2 | methyl-CpG binding domain protein 2 | 10116 | RGD:1595452 | Inparanoid, OMA, EggNOG |
| Horse | 100070096 | MBD2 | methyl-CpG binding domain protein 2 | 9796 | VGNC:20006 | Inparanoid, OMA, EggNOG |
| Pig | 100511112 | MBD2 | methyl-CpG binding domain protein 2 | 9823 | | OMA, EggNOG |
| Opossum | 100009966 | MBD2 | methyl-CpG binding domain protein 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100216281 | mbd2 | methyl-CpG binding domain protein 2 | 8364 | XB-GENE-493776 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
