The store will not work correctly when cookies are disabled.
Protein or Target Summary
Sperm mitochondrial-associated cysteine-rich protein
| Gene ID | 4184 |
|---|
| uniprot | P49901 |
|---|
| Gene Name | SMCP |
|---|
| Ensernbl ID | ENSP00000357754 |
|---|
| Sequence | MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4184 | SMCP | Sperm mitochondrial-associated cysteine-rich protein | P49901 |
| MOUSE | 17235 | Smcp | Sperm mitochondrial-associated cysteine-rich protein | P15265 |
| RAT | 24899 | Smcp | Sperm mitochondrial-associated cysteine-rich protein | Q64298 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
