Protein or Target Summary

Serine/threonine-protein kinase Nek6

Gene ID	10783
uniprot	Q9HC98
Gene Name	NEK6
Ensernbl ID	ENSP00000362702
Family	Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
Sequence	MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10783	NEK6	Serine/threonine-protein kinase Nek6	Q9HC98
MOUSE		Nek6	Serine/threonine-protein kinase Nek6	A2ATP1
MOUSE		Nek6	Serine/threonine-protein kinase Nek6	A2ATN9
MOUSE		Nek6	Serine/threonine-protein kinase Nek6	A2ATP0
MOUSE	59126	Nek6	Serine/threonine-protein kinase Nek6	Q9ES70
RAT	360161	Nek6	NIMA (Never in mitosis gene a)-related expressed kinase 6, isoform CRA_a	B1H218
RAT	360161	Nek6	Serine/threonine-protein kinase Nek6	P59895

Protein Classes

PANTHER Classes
protein    /    protein kinase    /    Serine/threonine-protein kinase nek6
protein    /    transferase    /    Serine/threonine-protein kinase nek6
protein    /    kinase    /    Serine/threonine-protein kinase nek6

DTO Classes
protein / Kinase / Protein kinase / Other group / NEK family / Serine/threonine-protein kinase nek6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx