The store will not work correctly when cookies are disabled.
Protein or Target Summary
N-terminal EF-hand calcium-binding protein 3
| Gene ID | 63941 |
|---|
| uniprot | Q96P71 |
|---|
| Gene Name | NECAB3 |
|---|
| Ensernbl ID | ENSP00000246190 |
|---|
| Sequence | MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 63941 | NECAB3 | N-terminal EF-hand calcium-binding protein 3 | Q96P71 |
| MOUSE | | Necab3 | N-terminal EF-hand calcium-binding protein 3 | A2AKF0 |
| MOUSE | 56846 | Necab3 | N-terminal EF-hand calcium-binding protein 3 | Q9D6J4 |
| RAT | 311562 | Necab3 | Amyloid beta (A4) protein-binding, family A, member 1 binding protein (Predicted), isoform CRA_b | D3ZKY0 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
