The store will not work correctly when cookies are disabled.
MBNL1
| Description | Muscleblind-like protein 1 |
|---|
Gene and Protein Information
| Gene ID | 4154 |
|---|
| Uniprot Accession IDs | E9PBW7 O43311 O43797 Q86UV8 Q86UV9 Q96P92 Q96RE3 |
|---|
| Ensembl ID | ENSP00000282486 |
|---|
| Symbol | EXP KIAA0428 MBNL EXP MBNL |
|---|
| Family | Belongs to the muscleblind family. |
|---|
| Sequence | MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460787 | MBNL1 | muscleblind like splicing regulator 1 | 9598 | VGNC:2039 | OMA, EggNOG |
| Macaque | 708735 | MBNL1 | muscleblind like splicing regulator 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 56758 | Mbnl1 | muscleblind like splicing factor 1 | 10090 | MGI:1928482 | Inparanoid, OMA, EggNOG |
| Rat | 282635 | Mbnl1 | muscleblind-like splicing regulator 1 | 10116 | RGD:628668 | Inparanoid, OMA, EggNOG |
| Dog | 477116 | MBNL1 | muscleblind like splicing regulator 1 | 9615 | VGNC:43057 | Inparanoid, OMA, EggNOG |
| Horse | 100050018 | MBNL1 | muscleblind like splicing regulator 1 | 9796 | VGNC:20014 | Inparanoid, OMA, EggNOG |
| Cow | 781653 | MBNL1 | muscleblind like splicing regulator 1 | 9913 | VGNC:31283 | Inparanoid, OMA, EggNOG |
| Pig | 100525306 | MBNL1 | muscleblind like splicing regulator 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100012831 | MBNL1 | muscleblind like splicing regulator 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | MBNL1 | muscleblind like splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:6923] | 9258 | | OMA, EggNOG |
| Xenopus | | mbnl1 | muscleblind like splicing regulator 1 [Source:Xenbase;Acc:XB-GENE-6035557] | 8364 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
