JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Dual specificity mitogen-activated protein kinase kinase 6

Gene ID	5608
uniprot	P52564
Gene Name	MAP2K6
Ensernbl ID	ENSP00000468348
Family	Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Sequence	MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5608	MAP2K6	Dual specificity mitogen-activated protein kinase kinase 6	P52564
MOUSE		Map2k6	Uncharacterized protein	Q3UU57
MOUSE		Map2k6	Map kinase kinase	P70273
MOUSE		Map2k6	Dual-specificity mitogen-activated protein kinase kinase 6	A2AGS2
MOUSE		Map2k6	Uncharacterized protein	Q8BP44
MOUSE		Map2k6	MAP kinase kinase 6c	Q60521
MOUSE	26399	Map2k6	Uncharacterized protein	Q543Z5
MOUSE	26399	Map2k6	Dual specificity mitogen-activated protein kinase kinase 6	P70236
RAT	114495	Map2k6	Mitogen-activated protein kinase kinase 6	Q925D6

Protein Classes

DTO Classes
protein / Kinase / Protein kinase / STE group / STE7 family / Dual specificity mitogen-activated protein kinase kinase 6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx