SLC25A10

Description	Mitochondrial dicarboxylate carrier

Gene and Protein Information

Gene ID	1468
Uniprot Accession IDs	Q542Z3 Q96BA1 Q96IP1
Ensembl ID	ENSP00000461324
Symbol	DIC DIC
Family	Belongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence	MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	714494	SLC25A10	solute carrier family 25 member 10	9544		Inparanoid, OMA
Mouse	27376	Slc25a10	solute carrier family 25 (mitochondrial carrier, dicarboxylate transporter), member 10	10090	MGI:1353497	Inparanoid, OMA
Rat	170943	Slc25a10	solute carrier family 25 member 10	10116	RGD:621430	Inparanoid, OMA
Opossum	100030196	LOC100030196	mitochondrial dicarboxylate carrier-like	13616		Inparanoid, OMA
Xenopus	549772	slc25a10	solute carrier family 25 member 10	8364	XB-GENE-955175	Inparanoid, OMA
S.cerevisiae	851063	DIC1	Dic1p	4932	S000004340	Inparanoid, OMA

Protein Classes

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial dicarboxylate carrier

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]