The store will not work correctly when cookies are disabled.
DKK1
| Description | Dickkopf-related protein 1 |
|---|
Gene and Protein Information
| Gene ID | 22943 |
|---|
| Uniprot Accession IDs | B2RC19 Dickkopf-1 |
|---|
| Ensembl ID | ENSP00000363081 |
|---|
| Symbol | SK DKK-1 |
|---|
| Family | Belongs to the dickkopf family. |
|---|
| Sequence | MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450465 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9598 | VGNC:1625 | OMA, EggNOG |
| Macaque | 702997 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 13380 | Dkk1 | dickkopf WNT signaling pathway inhibitor 1 | 10090 | MGI:1329040 | Inparanoid, OMA, EggNOG |
| Rat | 293897 | Dkk1 | dickkopf WNT signaling pathway inhibitor 1 | 10116 | RGD:1307313 | Inparanoid, OMA |
| Dog | 609600 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9615 | VGNC:52929 | Inparanoid, OMA |
| Horse | 100071881 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9796 | VGNC:51486 | Inparanoid, OMA |
| Cow | 504445 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9913 | VGNC:28079 | Inparanoid, OMA, EggNOG |
| Pig | 100157640 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Platypus | 100073484 | DKK1 | dickkopf WNT signaling pathway inhibitor 1 | 9258 | | Inparanoid, OMA |
| Xenopus | 549037 | dkk1 | dickkopf WNT signaling pathway inhibitor 1 | 8364 | XB-GENE-481644 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30197 | dkk1b | dickkopf WNT signaling pathway inhibitor 1b | 7955 | ZDB-GENE-990708-5 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
