JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

S-methyl-5'-thioadenosine phosphorylase

Gene ID	4507
uniprot	Q13126
Gene Name	MTAP
Ensernbl ID	ENSP00000369519
Family	Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.
Sequence	MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4507	MTAP	S-methyl-5'-thioadenosine phosphorylase	Q13126
MOUSE	66902	Mtap	S-methyl-5'-thioadenosine phosphorylase	Q9CQ65
RAT	298227	Mtap	S-methyl-5'-thioadenosine phosphorylase	A0A0G2K583
RAT	298227	Mtap	S-methyl-5'-thioadenosine phosphorylase	Q7TP15

Protein Classes

PANTHER Classes
protein / transferase / phosphorylase / S-methyl-5'-thioadenosine phosphorylase

DTO Classes
protein / Enzyme / Transferase / Phosphorylase / S-methyl-5'-thioadenosine phosphorylase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx