My Cart
0
You have no items in your shopping cart.
| Description | Transcription factor jun-D |
|---|
Gene and Protein Information
| Gene ID | 3727 |
|---|---|
| Uniprot Accession IDs | P17535 Q53EK9 |
| Ensembl ID | ENSP00000252818 |
| Symbol | AP-1 |
| Family | Belongs to the bZIP family. Jun subfamily. |
| Sequence | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 16478 | Jund | jun D proto-oncogene | 10090 | MGI:96648 | Inparanoid, OMA, EggNOG |
| Rat | 24518 | Jund | JunD proto-oncogene, AP-1 transcription factor subunit | 10116 | RGD:2945 | Inparanoid, OMA, EggNOG |
| Dog | 609409 | JUND | JunD proto-oncogene, AP-1 transcription factor subunit | 9615 | VGNC:42199 | Inparanoid, OMA |
| Opossum | JUND | JunD proto-oncogene, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:6206] | 13616 | Inparanoid, OMA | ||
| Xenopus | 100126216 | jund | jun D proto-oncogene | 8364 | XB-GENE-955776 | Inparanoid, OMA |
| Zebrafish | 564873 | jund | JunD proto-oncogene, AP-1 transcription factor subunit | 7955 | ZDB-GENE-070725-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Bibliography
| 1.Liberati, N T NT and 6 more authors. 1999-04-27 Smads bind directly to the Jun family of AP-1 transcription factors. [PMID:10220381] |
| 2.Imafuku, I I and 11 more authors. 1999-10-04 Presenilin 1 suppresses the function of c-Jun homodimers via interaction with QM/Jif-1. [PMID:10508860] |
| 3.Ubeda, M M, Vallejo, M M and Habener, J F JF. 1999-11 CHOP enhancement of gene transcription by interactions with Jun/Fos AP-1 complex proteins. [PMID:10523647] |
| 4.Miyamoto, N G NG and 6 more authors. 2000-06-01 Interleukin-1beta induction of the chemokine RANTES promoter in the human astrocytoma line CH235 requires both constitutive and inducible transcription factors. [PMID:10713367] |
| 5.Sharma, S C SC and Richards, J S JS. 2000-10-27 Regulation of AP1 (Jun/Fos) factor expression and activation in ovarian granulosa cells. Relation of JunD and Fra2 to terminal differentiation. [PMID:10934195] |
| 6.Yamamura, Y Y, Hua, X X, Bergelson, S S and Lodish, H F HF. 2000-11-17 Critical role of Smads and AP-1 complex in transforming growth factor-beta -dependent apoptosis. [PMID:10942775] |
| 7.Yazgan, O O and Pfarr, C M CM. 2001-02-01 Differential binding of the Menin tumor suppressor protein to JunD isoforms. [PMID:11221882] |
| 8.Faniello, Maria C MC and 11 more authors. 2002-04-01 An alternative model of H ferritin promoter transactivation by c-Jun. [PMID:11903046] |
| 9.Gemmill, Robert M RM and 8 more authors. 2002-05-16 The TRC8 hereditary kidney cancer gene suppresses growth and functions with VHL in a common pathway. [PMID:12032852] |
| 10.Yazgan, Oya O and Pfarr, Curt M CM. 2002-08-16 Regulation of two JunD isoforms by Jun N-terminal kinases. [PMID:12052834] |