JUND
| Description | Transcription factor jun-D |
|---|
Gene and Protein Information
| Gene ID | 3727 |
|---|---|
| Uniprot Accession IDs | Q53EK9 |
| Ensembl ID | ENSP00000252818 |
| Symbol | AP-1 |
| Family | Belongs to the bZIP family. Jun subfamily. |
| Sequence | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 16478 | Jund | jun D proto-oncogene | 10090 | MGI:96648 | Inparanoid, OMA, EggNOG |
| Rat | 24518 | Jund | JunD proto-oncogene, AP-1 transcription factor subunit | 10116 | RGD:2945 | Inparanoid, OMA, EggNOG |
| Dog | 609409 | JUND | JunD proto-oncogene, AP-1 transcription factor subunit | 9615 | VGNC:42199 | Inparanoid, OMA |
| Opossum | JUND | JunD proto-oncogene, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:6206] | 13616 | Inparanoid, OMA | ||
| Xenopus | 100126216 | jund | jun D proto-oncogene | 8364 | XB-GENE-955776 | Inparanoid, OMA |
| Zebrafish | 564873 | jund | JunD proto-oncogene, AP-1 transcription factor subunit | 7955 | ZDB-GENE-070725-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|