Protein or Target Summary
Transcription factor jun-D
| Gene ID | 3727 |
|---|---|
| uniprot | P17535 |
| Gene Name | JUND |
| Ensernbl ID | ENSP00000252818 |
| Family | Belongs to the bZIP family. Jun subfamily. |
| Sequence | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor jun-D
protein / transcription factor / nucleic acid binding / Transcription factor jun-D
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor jun-D
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx