The store will not work correctly when cookies are disabled.
MRGPRD
| Description | Mas-related G-protein coupled receptor member D |
|---|
Gene and Protein Information
| Gene ID | 116512 |
|---|
| Uniprot Accession IDs | Q8NGK7 |
|---|
| Ensembl ID | ENSP00000310631 |
|---|
| Symbol | MRGD MRGD TGR7 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. Mas subfamily. |
|---|
| Sequence | MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 466686 | MRGPRD | MAS related GPR family member D | 9598 | VGNC:12584 | OMA, EggNOG |
| Macaque | 709555 | MRGPRD | MAS related GPR family member D | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 211578 | Mrgprd | MAS-related GPR, member D | 10090 | MGI:3033142 | Inparanoid, OMA, EggNOG |
| Rat | 293648 | Mrgprd | MAS related GPR family member D | 10116 | RGD:738040 | Inparanoid, OMA, EggNOG |
| Cow | 615853 | LOC615853 | mas-related G-protein coupled receptor member D | 9913 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
