Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

NR1I2

DescriptionNuclear receptor subfamily 1 group I member 2

Gene and Protein Information

Gene ID8856
Uniprot Accession IDs Q006P5 Q008C8 Q96AC7 Q9UJ22 Q9UJ23 Q9UJ24 Q9UJ25 Q9UJ26 Q9UJ27 Q9UNW4
Ensembl ID ENSP00000336528
Symbol PXR BXR PAR PRR PXR SAR SXR ONR1 PAR1 PAR2 PARq
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp745458NR1I2nuclear receptor subfamily 1 group I member 29598VGNC:7079OMA, EggNOG
Macaque574226NR1I2nuclear receptor subfamily 1 group I member 29544Inparanoid, OMA, EggNOG
Mouse18171Nr1i2nuclear receptor subfamily 1, group I, member 210090MGI:1337040Inparanoid, OMA, EggNOG
Rat84385Nr1i2nuclear receptor subfamily 1, group I, member 210116RGD:69057Inparanoid, OMA, EggNOG
Dog403482NR1I2nuclear receptor subfamily 1 group I member 29615VGNC:53079Inparanoid, OMA, EggNOG
HorseNR1I2nuclear receptor subfamily 1 group I member 2 [Source:HGNC Symbol;Acc:HGNC:7968]9796OMA, EggNOG
Cow493713NR1I2nuclear receptor subfamily 1 group I member 29913VGNC:32233Inparanoid, OMA, EggNOG
Pig397228NR1I2nuclear receptor subfamily 1 group I member 29823OMA, EggNOG
OpossumNR1I2nuclear receptor subfamily 1 group I member 2 [Source:HGNC Symbol;Acc:HGNC:7968]13616Inparanoid, OMA, EggNOG
Xenopus100038168nr1i2nuclear receptor subfamily 1 group I member 28364XB-GENE-480112Inparanoid, OMA
Zebrafish565875nr1i2nuclear receptor subfamily 1, group I, member 27955ZDB-GENE-030903-3Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Nuclear receptor subfamily 1 group i member 2
protein    /    receptor    /    Nuclear receptor subfamily 1 group i member 2
protein    /    nucleic acid binding    /    Nuclear receptor subfamily 1 group i member 2
protein    /    C4 zinc finger nuclear receptor    /    Nuclear receptor subfamily 1 group i member 2
DTO Classes
protein    /    Nuclear receptor    /    Vitamin D receptor-like receptors    /    Nuclear receptor subfamily 1 group i member 2

Associated Recombinant Proteins

The page will load shortly, Thanks for your patience!
NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Dotzlaw, H H, Leygue, E E, Watson, P P and Murphy, L C LC. 1999-08 The human orphan receptor PXR messenger RNA is expressed in both normal and neoplastic breast tissue. [PMID:10473093]
      2.Xie, W W and 7 more authors. 2000-12-01 Reciprocal activation of xenobiotic response genes by nuclear receptors SXR/PXR and CAR. [PMID:11114890]
      3.Geick, A A, Eichelbaum, M M and Burk, O O. 2001-05-04 Nuclear receptor response elements mediate induction of intestinal MDR1 by rifampin. [PMID:11297522]
      4.Watkins, R E RE and 8 more authors. 2001-06-22 The human nuclear xenobiotic receptor PXR: structural determinants of directed promiscuity. [PMID:11408620]
      5.Zhang, J J and 19 more authors. 2001-10 The human pregnane X receptor: genomic structure and identification and functional characterization of natural allelic variants. [PMID:11668216]
      6.Gonzalez, Manuel Macias MM and Carlberg, Carsten C. 2002-05-24 Cross-repression, a functional consequence of the physical interaction of non-liganded nuclear receptors and POU domain transcription factors. [PMID:11891224]
      7.Takeshita, Akira A, Taguchi, Manabu M, Koibuchi, Noriyuki N and Ozawa, Yasunori Y. 2002-09-06 Putative role of the orphan nuclear receptor SXR (steroid and xenobiotic receptor) in the mechanism of CYP3A4 inhibition by xenobiotics. [PMID:12072427]
      8.Frungieri, Mónica B MB, Weidinger, Stephan S, Meineke, Viktor V, Köhn, Frank M FM and Mayerhofer, Artur A. 2002-11-12 Proliferative action of mast-cell tryptase is mediated by PAR2, COX2, prostaglandins, and PPARgamma : Possible relevance to human fibrotic disorders. [PMID:12397176]
      9.Fukuen, Shuichi S and 6 more authors. 2002-11-01 Identification of the novel splicing variants for the hPXR in human livers. [PMID:12413960]
      10.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]