The store will not work correctly when cookies are disabled.
MPC1L
| Description | Mitochondrial pyruvate carrier 1-like protein |
|---|
Gene and Protein Information
| Gene ID | 347411 |
|---|
| Uniprot Accession IDs | P0DKB6 |
|---|
| Symbol | SLC54A3 |
|---|
| Family | Belongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family. |
|---|
| Sequence | MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| S.cerevisiae | 852800 | MPC1 | pyruvate transporter MPC1 | 4932 | S000003048 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
