Protein or Target Summary
Mitochondrial pyruvate carrier 1-like protein
| Gene ID | 347411 |
|---|---|
| uniprot | P0DKB6 |
| Gene Name | MPC1L |
| Ensernbl ID | |
| Family | Belongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family. |
| Sequence | MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1-like protein
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1-like protein
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx