The store will not work correctly when cookies are disabled.
Protein or Target Summary
Carbonic anhydrase 5B, mitochondrial
| Target ID | 12958 |
|---|
| Gene ID | 11238 |
|---|
| uniprot | Q9Y2D0 |
|---|
| Gene Name | CA5B |
|---|
| Ensernbl ID | ENSP00000314099 |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 11238 | CA5B | Carbonic anhydrase 5B, mitochondrial | Q9Y2D0 |
| MOUSE | 56078 | Ca5b | Carbonic anhydrase 5B, mitochondrial | Q9QZA0 |
| RAT | 302669 | Ca5b | Carbonic anhydrase 5B, mitochondrial | Q66HG6 |
Pathway
| Data Source | Name | Explore in Pharos | Explore in Source |
|---|
