The store will not work correctly when cookies are disabled.
CA5B
| Description | Carbonic anhydrase 5B, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 11238 |
|---|
| Uniprot Accession IDs | A8K4T5 |
|---|
| Ensembl ID | ENSP00000314099 |
|---|
| Symbol | CAVB CA-VB |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 713128 | CA5B | carbonic anhydrase 5B | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 56078 | Car5b | carbonic anhydrase 5b, mitochondrial | 10090 | MGI:1926249 | Inparanoid, OMA, EggNOG |
| Rat | 302669 | Car5b | carbonic anhydrase 5B | 10116 | RGD:1549783 | Inparanoid, OMA, EggNOG |
| Dog | 100856271 | CA5B | carbonic anhydrase 5B | 9615 | VGNC:38613 | Inparanoid, OMA, EggNOG |
| Horse | 100051095 | LOC100051095 | carbonic anhydrase 5B, mitochondrial | 9796 | | OMA, EggNOG |
| Cow | 514494 | CA5B | carbonic anhydrase 5B | 9913 | VGNC:26655 | Inparanoid, OMA, EggNOG |
| Pig | 100156418 | CA5B | carbonic anhydrase 5B | 9823 | | OMA, EggNOG |
| Opossum | 100031763 | CA5B | carbonic anhydrase 5B | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | CA5B | carbonic anhydrase 5B [Source:HGNC Symbol;Acc:HGNC:1378] | 9258 | | OMA, EggNOG |
| Xenopus | 733981 | ca5b | carbonic anhydrase VB, mitochondrial | 8364 | XB-GENE-1003819 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
