The store will not work correctly when cookies are disabled.
Protein or Target Summary
Carbonic anhydrase 5B, mitochondrial
Target ID | 12958 |
Gene ID | 11238 |
uniprot | Q9Y2D0 |
Gene Name | CA5B |
Ensernbl ID | ENSP00000314099 |
Family | Belongs to the alpha-carbonic anhydrase family. |
Sequence | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 11238 | CA5B | Carbonic anhydrase 5B, mitochondrial | Q9Y2D0 |
MOUSE | 56078 | Ca5b | Carbonic anhydrase 5B, mitochondrial | Q9QZA0 |
RAT | 302669 | Ca5b | Carbonic anhydrase 5B, mitochondrial | Q66HG6 |
Pathway
Data Source | Name | Explore in Pharos | Explore in Source |
---|