CTSB
| Description | Cathepsin B |
|---|
Gene and Protein Information
| Gene ID | 1508 |
|---|---|
| Uniprot Accession IDs | B3KQR5 B3KRR5 Q503A6 Q96D87 |
| Ensembl ID | ENSP00000345672 |
| Symbol | CPSB APPS CPSB RECEUP |
| Family | Belongs to the peptidase C1 family. |
| Sequence | MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463993 | CTSB | cathepsin B | 9598 | VGNC:897 | OMA, EggNOG |
| Macaque | 100424758 | CTSB | cathepsin B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13030 | Ctsb | cathepsin B | 10090 | MGI:88561 | Inparanoid, OMA, EggNOG |
| Rat | 64529 | Ctsb | cathepsin B | 10116 | RGD:621509 | Inparanoid, OMA, EggNOG |
| Dog | 486077 | CTSB | cathepsin B | 9615 | VGNC:39709 | Inparanoid, OMA, EggNOG |
| Horse | 100060963 | CTSB | cathepsin B | 9796 | VGNC:16948 | Inparanoid, OMA, EggNOG |
| Cow | 281105 | CTSB | cathepsin B | 9913 | VGNC:27813 | Inparanoid, OMA, EggNOG |
| Pig | 100037961 | CTSB | cathepsin B | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100032681 | CTSB | cathepsin B | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100563878 | ctsb | cathepsin B | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394833 | ctsb | cathepsin B | 8364 | XB-GENE-1000505 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406645 | ctsba | cathepsin Ba | 7955 | ZDB-GENE-040426-2650 | Inparanoid, OMA, EggNOG |
| C. elegans | 179637 | cpr-1 | Gut-specific cysteine proteinase | 6239 | OMA, EggNOG | |
| Fruitfly | 32341 | CtsB1 | Cathepsin B1 | 7227 | FBgn0030521 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / protease inhibitor / Cathepsin B
protein / cysteine protease / Cathepsin B
protein / protease / Cathepsin B
protein / hydrolase / Cathepsin B
protein / protease inhibitor / Cathepsin B
protein / cysteine protease / Cathepsin B
protein / protease / Cathepsin B
protein / hydrolase / Cathepsin B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|