The store will not work correctly when cookies are disabled.
CYP11B2
| Description | Cytochrome P450 11B2, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1585 |
|---|
| Uniprot Accession IDs | B0ZBE4 Q16726 |
|---|
| Ensembl ID | ENSP00000325822 |
|---|
| Symbol | CPN2 ALDOS CYP11B CYP11BL CYPXIB2 P450C18 P-450C18 P450aldo |
|---|
| Family | Belongs to the cytochrome P450 family. |
|---|
| Sequence | MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 110115 | Cyp11b1 | cytochrome P450, family 11, subfamily b, polypeptide 1 | 10090 | MGI:88583 | OMA, EggNOG |
| Rat | | Cyp11b2 | cytochrome P450, family 11, subfamily b, polypeptide 2 [Source:RGD Symbol;Acc:2454] | 10116 | | OMA, EggNOG |
| Dog | 482071 | CYP11B2 | cytochrome P450, family 11, subfamily B, polypeptide 2 | 9615 | | OMA, EggNOG |
| Horse | 100063645 | LOC100063645 | cytochrome P450 11B1, mitochondrial-like | 9796 | | OMA, EggNOG |
| Cow | 787628 | LOC787628 | cytochrome P450 11B1, mitochondrial | 9913 | | OMA, EggNOG |
| Opossum | 100032885 | LOC100032885 | cytochrome P450 11B1, mitochondrial | 13616 | | OMA, EggNOG |
| Anole lizard | 100560890 | LOC100560890 | cytochrome P450 11B, mitochondrial | 28377 | | OMA, EggNOG |
| Zebrafish | 791124 | cyp11c1 | cytochrome P450, family 11, subfamily C, polypeptide 1 | 7955 | ZDB-GENE-070828-1 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
