The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cytochrome P450 11B2, mitochondrial
| Gene ID | 1585 |
|---|
| uniprot | P19099 |
|---|
| Gene Name | CYP11B2 |
|---|
| Ensernbl ID | ENSP00000325822 |
|---|
| Family | Belongs to the cytochrome P450 family. |
|---|
| Sequence | MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1585 | CYP11B2 | Cytochrome P450 11B2, mitochondrial | P19099 |
| MOUSE | 13072 | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | G3UWE4 |
| MOUSE | 13072 | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | P15539 |
| RAT | | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | A0A0G2QC14 |
| RAT | | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | F1LPS4 |
| RAT | | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | A0A0G2K9N5 |
| RAT | | Cyp11b2 | Cytochrome P450 11B2, mitochondrial | P30099 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
