Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CA6

DescriptionCarbonic anhydrase 6

Gene and Protein Information

Gene ID765
Uniprot Accession IDs E7EMQ1 Q5FBW3 Q5FC00 Q96QX8 Q9UF03
Ensembl ID ENSP00000366654
Symbol CA-VI GUSTIN
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457915CA6carbonic anhydrase 69598VGNC:9850OMA, EggNOG
Macaque709540CA6carbonic anhydrase 69544OMA, EggNOG
Mouse12353Car6carbonic anhydrase 610090MGI:1333786Inparanoid, OMA, EggNOG
Rat298657Car6carbonic anhydrase 610116RGD:70516Inparanoid, OMA, EggNOG
Dog403503CA6carbonic anhydrase 69615VGNC:38614Inparanoid, OMA, EggNOG
Horse100051818CA6carbonic anhydrase 69796VGNC:15966Inparanoid, OMA, EggNOG
Cow280742CA6carbonic anhydrase 69913VGNC:26656Inparanoid, OMA, EggNOG
Pig100240717CA6carbonic anhydrase 69823Inparanoid, OMA, EggNOG
Opossum100617216CA6carbonic anhydrase 613616Inparanoid, OMA, EggNOG
Xenopus779937ca6carbonic anhydrase 68364XB-GENE-494019Inparanoid, EggNOG

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      lung cancer4468Expression AtlasMONDO:0008903
      non-inflammatory breast cancer3880Expression AtlasMONDO:0007254
      psoriasis6696Expression AtlasMONDO:0005083
      tuberculosis and treatment for 3 months2482Expression AtlasMONDO:0018076

      Bibliography

      1.Leinonen, J J, Kivelä, J J, Parkkila, S S, Parkkila, A K AK and Rajaniemi, H H.Salivary carbonic anhydrase isoenzyme VI is located in the human enamel pellicle. [PMID:10207193]
      2.Nishimori, I I, FujikawaAdachi, K K, Onishi, S S and Hollingsworth, M A MA. 1999-06-30 Carbonic anhydrase in human pancreas: hypotheses for the pathophysiological roles of CA isozymes. [PMID:10415846]
      3.Kivela, J J, Parkkila, S S, Parkkila, A K AK, Leinonen, J J and Rajaniemi, H H. 1999-10-15 Salivary carbonic anhydrase isoenzyme VI. [PMID:10523402]
      4.Redman, R S RS, Peagler, F D FD and Johansson, I I. 2000-03-01 Immunohistochemical localization of carbonic anhydrases I, II, and VI in the developing rat sublingual and submandibular glands. [PMID:10705347]
      5.Nishimori, I I and Onishi, S S.Carbonic anhydrase isozymes in the human pancreas. [PMID:11303978]
      6.Leinonen, J J, Parkkila, S S, Kaunisto, K K, Koivunen, P P and Rajaniemi, H H. 2001-05 Secretion of carbonic anhydrase isoenzyme VI (CA VI) from human and rat lingual serous von Ebner's glands. [PMID:11304804]
      7.Karhumaa, P P and 5 more authors. 2001-09-25 The identification of secreted carbonic anhydrase VI as a constitutive glycoprotein of human and rat milk. [PMID:11553764]
      8. and Breton, S S. 2001-07 The cellular physiology of carbonic anhydrases. [PMID:11875253]
      9.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      10.Suzuki, Yutaka Y and 7 more authors. 2004-09 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. [PMID:15342556]