The store will not work correctly when cookies are disabled.
CA6
Description | Carbonic anhydrase 6 |
---|
Gene and Protein Information
Gene ID | 765 |
Uniprot Accession IDs | E7EMQ1 Q5FBW3 Q5FC00 Q96QX8 Q9UF03 |
Ensembl ID | ENSP00000366654 |
Symbol | CA-VI GUSTIN |
Family | Belongs to the alpha-carbonic anhydrase family. |
Sequence | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 457915 | CA6 | carbonic anhydrase 6 | 9598 | VGNC:9850 | OMA, EggNOG |
Macaque | 709540 | CA6 | carbonic anhydrase 6 | 9544 | | OMA, EggNOG |
Mouse | 12353 | Car6 | carbonic anhydrase 6 | 10090 | MGI:1333786 | Inparanoid, OMA, EggNOG |
Rat | 298657 | Car6 | carbonic anhydrase 6 | 10116 | RGD:70516 | Inparanoid, OMA, EggNOG |
Dog | 403503 | CA6 | carbonic anhydrase 6 | 9615 | VGNC:38614 | Inparanoid, OMA, EggNOG |
Horse | 100051818 | CA6 | carbonic anhydrase 6 | 9796 | VGNC:15966 | Inparanoid, OMA, EggNOG |
Cow | 280742 | CA6 | carbonic anhydrase 6 | 9913 | VGNC:26656 | Inparanoid, OMA, EggNOG |
Pig | 100240717 | CA6 | carbonic anhydrase 6 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100617216 | CA6 | carbonic anhydrase 6 | 13616 | | Inparanoid, OMA, EggNOG |
Xenopus | 779937 | ca6 | carbonic anhydrase 6 | 8364 | XB-GENE-494019 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|