The store will not work correctly when cookies are disabled.
CALCB
| Description | Calcitonin gene-related peptide 2 |
|---|
Gene and Protein Information
| Gene ID | 797 |
|---|
| Uniprot Accession IDs | A8K573 D3DQX4 Q569I0 Q9UCN9 |
|---|
| Ensembl ID | ENSP00000433490 |
|---|
| Symbol | CALC2 CALC2 CGRP2 CGRP-II |
|---|
| Family | Belongs to the calcitonin family. |
|---|
| Sequence | MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451044 | CALCB | calcitonin related polypeptide beta | 9598 | VGNC:7798 | OMA, EggNOG |
| Macaque | 698209 | LOC698209 | calcitonin gene-related peptide 2 | 9544 | | OMA, EggNOG |
| Mouse | 116903 | Calcb | calcitonin-related polypeptide, beta | 10090 | MGI:2151254 | Inparanoid, OMA, EggNOG |
| Rat | 171519 | Calcb | calcitonin-related polypeptide, beta | 10116 | RGD:620997 | Inparanoid, OMA, EggNOG |
| Dog | 403415 | CALCB | calcitonin-related polypeptide beta | 9615 | | Inparanoid, EggNOG |
| Horse | 100034126 | CALCB | calcitonin-related polypeptide beta | 9796 | | Inparanoid, OMA, EggNOG |
| Opossum | 100029093 | CALCB | calcitonin related polypeptide beta | 13616 | | OMA, EggNOG |
| Zebrafish | 436744 | calca | calcitonin/calcitonin-related polypeptide, alpha | 7955 | ZDB-GENE-040718-173 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
