The store will not work correctly when cookies are disabled.
CBX7
Description | Chromobox protein homolog 7 |
---|
Gene and Protein Information
Gene ID | 23492 |
Uniprot Accession IDs | Q86T17 |
Ensembl ID | ENSP00000216133 |
Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
---|
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 23492 | CBX7 | Chromobox protein homolog 7 | O95931 |
MOUSE | 52609 | Cbx7 | Chromobox protein homolog 7 | Q8VDS3 |
MOUSE | | Cbx7 | Chromobox protein homolog 7 | D3YYK4 |
MOUSE | | Cbx7 | Chromobox protein homolog 7 | F6WJA6 |
MOUSE | | Cbx7 | Chromobox protein homolog 7 | D3YY71 |
MOUSE | | Cbx7 | Chromobox protein homolog 7 | H3BK45 |
MOUSE | 52609 | Cbx7 | Chromobox protein homolog 7 | F8WHN2 |
RAT | 362962 | Cbx7 | Chromobox protein homolog 7 | P60889 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|