JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
CBX7

CBX7

Description	Chromobox protein homolog 7

Gene and Protein Information

Gene ID	23492
Uniprot Accession IDs	Q86T17
Ensembl ID	ENSP00000216133
Sequence	MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458843	CBX7	chromobox 7	9598	VGNC:5239	OMA, EggNOG
Macaque	703056	CBX7	chromobox 7	9544		Inparanoid, OMA
Dog	481247	CBX7	chromobox 7	9615	VGNC:38768	Inparanoid, OMA
Cow	525770	CBX7	chromobox 7	9913	VGNC:26820	Inparanoid, OMA
Opossum		CBX7	chromobox 7 [Source:HGNC Symbol;Acc:HGNC:1557]	13616		Inparanoid, OMA
Anole lizard	100564588	cbx7	chromobox 7	28377		Inparanoid, OMA
Xenopus	448638	cbx7	chromobox 7	8364	XB-GENE-942584	Inparanoid, OMA

Protein Classes

DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]