CBX7

DescriptionChromobox protein homolog 7

Gene and Protein Information

Gene ID23492
Uniprot Accession IDs Q86T17
Ensembl ID ENSP00000216133
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
SpeciesGene IDGene SymbolGene NameUniprot
HUMAN23492CBX7Chromobox protein homolog 7O95931
MOUSE52609Cbx7Chromobox protein homolog 7Q8VDS3
MOUSECbx7Chromobox protein homolog 7D3YYK4
MOUSECbx7Chromobox protein homolog 7F6WJA6
MOUSECbx7Chromobox protein homolog 7D3YY71
MOUSECbx7Chromobox protein homolog 7H3BK45
MOUSE52609Cbx7Chromobox protein homolog 7F8WHN2
RAT362962Cbx7Chromobox protein homolog 7P60889

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 7

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source