The store will not work correctly when cookies are disabled.
CA13
| Description | Carbonic anhydrase 13 |
|---|
Gene and Protein Information
| Gene ID | 377677 |
|---|
| Uniprot Accession IDs | Q8N1Q1 |
|---|
| Ensembl ID | ENSP00000318912 |
|---|
| Symbol | CAXIII |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 747299 | CA13 | carbonic anhydrase 13 | 9598 | VGNC:12000 | OMA, EggNOG |
| Mouse | 71934 | Car13 | carbonic anhydrase 13 | 10090 | MGI:1931322 | Inparanoid, OMA, EggNOG |
| Rat | 499566 | Car13 | carbonic anhydrase 13 | 10116 | RGD:1560453 | Inparanoid, OMA, EggNOG |
| Dog | 487030 | CA13 | carbonic anhydrase 13 | 9615 | VGNC:38608 | Inparanoid, OMA, EggNOG |
| Horse | | CA13 | carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914] | 9796 | | OMA, EggNOG |
| Cow | 513850 | CA13 | carbonic anhydrase 13 | 9913 | VGNC:26651 | Inparanoid, OMA, EggNOG |
| Pig | 100152714 | LOC100152714 | carbonic anhydrase 13 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100018677 | LOC100018677 | carbonic anhydrase 13 | 13616 | | OMA, EggNOG |
| Platypus | | CA13 | carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914] | 9258 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
