Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CA1

DescriptionCarbonic anhydrase 1

Gene and Protein Information

Gene ID759
Uniprot Accession IDs P00915
Ensembl ID ENSP00000430656
Symbol CAB CA-I Car1 HEL-S-11
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464264CA1carbonic anhydrase 19598VGNC:10213Inparanoid, OMA
Macaque703701CA1carbonic anhydrase 19544Inparanoid, OMA
Mouse12346Car1carbonic anhydrase 110090MGI:88268Inparanoid, OMA
Rat310218Car1carbonic anhydrase I10116RGD:1309780Inparanoid, OMA
Dog487031CA1carbonic anhydrase 19615VGNC:38604Inparanoid, OMA
Cow510801CA1carbonic anhydrase I9913Inparanoid, OMA
Opossum497246CA1carbonic anhydrase 113616Inparanoid, OMA
Xenopus100496485ca1carbonic anhydrase I8364XB-GENE-957160Inparanoid, OMA

Associated Recombinant Proteins

The page will load shortly, Thanks for your patience!
NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!