JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
CA1

CA1

Description	Carbonic anhydrase 1

Gene and Protein Information

Gene ID	759
Uniprot Accession IDs	P00915
Ensembl ID	ENSP00000430656
Symbol	CAB CA-I Car1 HEL-S-11
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464264	CA1	carbonic anhydrase 1	9598	VGNC:10213	Inparanoid, OMA
Macaque	703701	CA1	carbonic anhydrase 1	9544		Inparanoid, OMA
Mouse	12346	Car1	carbonic anhydrase 1	10090	MGI:88268	Inparanoid, OMA
Rat	310218	Car1	carbonic anhydrase I	10116	RGD:1309780	Inparanoid, OMA
Dog	487031	CA1	carbonic anhydrase 1	9615	VGNC:38604	Inparanoid, OMA
Cow	510801	CA1	carbonic anhydrase I	9913		Inparanoid, OMA
Opossum	497246	CA1	carbonic anhydrase 1	13616		Inparanoid, OMA
Xenopus	100496485	ca1	carbonic anhydrase I	8364	XB-GENE-957160	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]