The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CA1
Description | Carbonic anhydrase 1 |
---|
Gene and Protein Information
Gene ID | 759 |
Uniprot Accession IDs | P00915 |
Ensembl ID | ENSP00000430656 |
Symbol | CAB CA-I Car1 HEL-S-11 |
Family | Belongs to the alpha-carbonic anhydrase family. |
Sequence | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
---|
Homologous gene and protein info.
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!