JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
CA3

CA3

Description	Carbonic anhydrase 3

Gene and Protein Information

Gene ID	761
Uniprot Accession IDs	B2R867 B3KUC8 O60842
Ensembl ID	ENSP00000285381
Symbol	Car3 CAIII
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	703801	CA3	carbonic anhydrase 3	9544		Inparanoid, OMA, EggNOG
Mouse	12350	Car3	carbonic anhydrase 3	10090	MGI:88270	Inparanoid, OMA, EggNOG
Rat	54232	Car3	carbonic anhydrase 3	10116	RGD:2241	Inparanoid, OMA, EggNOG
Dog	487032	CA3	carbonic anhydrase 3	9615	VGNC:38611	Inparanoid, OMA, EggNOG
Horse	100050125	CA3	carbonic anhydrase 3	9796	VGNC:15964	Inparanoid, OMA, EggNOG
Cow	513212	CA3	carbonic anhydrase 3	9913	VGNC:26653	Inparanoid, OMA, EggNOG
Pig	494016	CA3	carbonic anhydrase 3	9823		Inparanoid, OMA, EggNOG
Opossum	100018604	CA3	carbonic anhydrase 3	13616		Inparanoid, OMA, EggNOG
Platypus		CA3	carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]	9258		OMA, EggNOG
Xenopus	100496328	ca3	carbonic anhydrase III	8364	XB-GENE-1007186	OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source