The store will not work correctly when cookies are disabled.
Protein or Target Summary
Carbonic anhydrase 3
| Gene ID | 761 |
|---|
| uniprot | P07451 |
|---|
| Gene Name | CA3 |
|---|
| Ensernbl ID | ENSP00000285381 |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 761 | CA3 | Carbonic anhydrase 3 | P07451 |
| MOUSE | | ca3 | Carbonic anhydrase III | O70580 |
| MOUSE | 12350 | Ca3 | Carbonic anhydrase 3 | P16015 |
| RAT | 54232 | Ca3 | Carbonic anhydrase 3 | P14141 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
