The store will not work correctly when cookies are disabled.
CTSD
Gene and Protein Information
| Gene ID | 1509 |
|---|
| Uniprot Accession IDs | Q6IB57 |
|---|
| Ensembl ID | ENSP00000236671 |
|---|
| Symbol | CPSD CPSD CLN10 HEL-S-130P |
|---|
| Family | Belongs to the peptidase A1 family. |
|---|
| Sequence | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 703534 | CTSD | cathepsin D | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 13033 | Ctsd | cathepsin D | 10090 | MGI:88562 | Inparanoid, OMA, EggNOG |
| Rat | 171293 | Ctsd | cathepsin D | 10116 | RGD:621511 | Inparanoid, OMA, EggNOG |
| Dog | 483662 | CTSD | cathepsin D | 9615 | | Inparanoid, OMA |
| Cow | 282883 | CTSD | cathepsin D | 9913 | | Inparanoid, OMA |
| Chicken | 396090 | CTSD | cathepsin D | 9031 | CGNC:4989 | Inparanoid, OMA |
| Anole lizard | 100567238 | ctsd | cathepsin D | 28377 | | Inparanoid, OMA |
| Zebrafish | 65225 | ctsd | cathepsin D | 7955 | ZDB-GENE-010131-8 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
