CAV3
Description | Caveolin-3 |
---|
Gene and Protein Information
Gene ID | 859 |
---|---|
Uniprot Accession IDs | A8K777 Q3T1A4 |
Ensembl ID | ENSP00000341940 |
Symbol | LQT9 MPDT RMD2 VIP21 LGMD1C VIP-21 |
Family | Belongs to the caveolin family. |
Sequence | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 738786 | CAV3 | caveolin 3 | 9598 | VGNC:1753 | OMA, EggNOG |
Macaque | 702163 | CAV3 | caveolin 3 | 9544 | Inparanoid, OMA, EggNOG | |
Mouse | 12391 | Cav3 | caveolin 3 | 10090 | MGI:107570 | Inparanoid, OMA, EggNOG |
Rat | 29161 | Cav3 | caveolin 3 | 10116 | RGD:2281 | Inparanoid, OMA, EggNOG |
Dog | 484671 | CAV3 | caveolin 3 | 9615 | VGNC:38753 | Inparanoid, OMA, EggNOG |
Horse | CAV3 | caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529] | 9796 | OMA, EggNOG | ||
Cow | 615310 | CAV3 | caveolin 3 | 9913 | VGNC:26801 | Inparanoid, OMA, EggNOG |
Opossum | 100023521 | CAV3 | caveolin 3 | 13616 | Inparanoid, OMA, EggNOG | |
Chicken | 378796 | CAV3 | caveolin 3 | 9031 | CGNC:6328 | Inparanoid, OMA |
Anole lizard | 100552705 | LOC100552705 | caveolin-3-like | 28377 | OMA, EggNOG | |
Xenopus | 100125124 | cav3.1 | caveolin 3, gene 1 | 8364 | XB-GENE-962905 | Inparanoid, OMA |
Xenopus | 100124941 | cav3.2 | caveolin 3, gene 2 | 8364 | XB-GENE-5815090 | OMA, EggNOG |
Zebrafish | 449679 | cav3 | caveolin 3 | 7955 | ZDB-GENE-050522-426 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Caveolin-3
protein / enzyme modulator / membrane traffic protein / Caveolin-3
protein / enzyme modulator / structural protein / Caveolin-3
protein / enzyme modulator / transmembrane receptor regulatory/adaptor protein / Caveolin-3
protein / enzyme modulator / G-protein modulator / Caveolin-3
protein / enzyme modulator / membrane traffic protein / Caveolin-3
protein / enzyme modulator / structural protein / Caveolin-3
protein / enzyme modulator / transmembrane receptor regulatory/adaptor protein / Caveolin-3
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|