The store will not work correctly when cookies are disabled.
CBS
Description | Cystathionine beta-synthase |
---|
Gene and Protein Information
Gene ID | 875 |
Uniprot Accession IDs | B2R993 D3DSK4 Q99425 Q9BWC5 |
Ensembl ID | ENSP00000381231 |
Symbol | CBSL HIP4 |
Family | Belongs to the cysteine synthase/cystathionine beta-synthase family. |
Sequence | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 736626 | CBS | cystathionine-beta-synthase | 9598 | | OMA, EggNOG |
Mouse | 12411 | Cbs | cystathionine beta-synthase | 10090 | MGI:88285 | Inparanoid, OMA, EggNOG |
Rat | 24250 | Cbs | cystathionine beta synthase | 10116 | RGD:2287 | Inparanoid, OMA, EggNOG |
Dog | 611071 | CBS | cystathionine-beta-synthase | 9615 | | Inparanoid, EggNOG |
Horse | 100146156 | LOC100146156 | cystathionine beta-synthase-like | 9796 | | OMA, EggNOG |
Cow | 514525 | CBS | cystathionine-beta-synthase | 9913 | | Inparanoid, OMA, EggNOG |
Opossum | 100024374 | CBS | cystathionine-beta-synthase | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 418545 | CBS | cystathionine-beta-synthase | 9031 | CGNC:12106 | Inparanoid, OMA, EggNOG |
Anole lizard | 100566358 | LOC100566358 | cystathionine beta-synthase | 28377 | | OMA, EggNOG |
Zebrafish | 550524 | cbsa | cystathionine-beta-synthase a | 7955 | ZDB-GENE-050417-367 | Inparanoid, OMA |
Zebrafish | 266987 | cbsb | cystathionine-beta-synthase b | 7955 | ZDB-GENE-021030-3 | OMA, EggNOG |
S.cerevisiae | 853059 | CYS4 | cystathionine beta-synthase CYS4 | 4932 | S000003387 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|