CASP6
| Description | Caspase-6 |
|---|
Gene and Protein Information
| Gene ID | 839 |
|---|---|
| Uniprot Accession IDs | Q9BQE7 CASP-6 |
| Ensembl ID | ENSP00000265164 |
| Symbol | MCH2 MCH2 |
| Family | Belongs to the peptidase C14A family. |
| Sequence | MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN |
Protein Classes
PANTHER Classes
protein / enzyme modulator / protease inhibitor / Caspase-6
protein / enzyme modulator / cysteine protease / Caspase-6
protein / enzyme modulator / protease / Caspase-6
protein / enzyme modulator / hydrolase / Caspase-6
protein / enzyme modulator / protease inhibitor / Caspase-6
protein / enzyme modulator / cysteine protease / Caspase-6
protein / enzyme modulator / protease / Caspase-6
protein / enzyme modulator / hydrolase / Caspase-6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|