The store will not work correctly when cookies are disabled.
BST1
| Description | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 |
|---|
Gene and Protein Information
| Gene ID | 683 |
|---|
| Uniprot Accession IDs | B2R6A2 Q1XII0 Q5U0K0 Q96EN3 |
|---|
| Ensembl ID | ENSP00000265016 |
|---|
| Symbol | CD157 |
|---|
| Family | Belongs to the ADP-ribosyl cyclase family. |
|---|
| Sequence | MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461126 | BST1 | bone marrow stromal cell antigen 1 | 9598 | VGNC:572 | OMA, EggNOG |
| Macaque | 722848 | BST1 | bone marrow stromal cell antigen 1 | 9544 | | OMA, EggNOG |
| Mouse | 12182 | Bst1 | bone marrow stromal cell antigen 1 | 10090 | MGI:105370 | Inparanoid, OMA, EggNOG |
| Rat | 81506 | Bst1 | bone marrow stromal cell antigen 1 | 10116 | RGD:620344 | Inparanoid, OMA, EggNOG |
| Dog | 488820 | BST1 | bone marrow stromal cell antigen 1 | 9615 | VGNC:38541 | Inparanoid, OMA, EggNOG |
| Cow | 616757 | BST1 | bone marrow stromal cell antigen 1 | 9913 | VGNC:26581 | Inparanoid, OMA, EggNOG |
| Pig | 100625942 | BST1 | bone marrow stromal cell antigen 1 | 9823 | | OMA, EggNOG |
| Opossum | 100015733 | BST1 | bone marrow stromal cell antigen 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 422828 | BST1 | bone marrow stromal cell antigen 1 | 9031 | CGNC:10784 | Inparanoid, OMA |
| Xenopus | | BST1 | bone marrow stromal cell antigen 1 [Source:HGNC Symbol;Acc:HGNC:1118] | 8364 | | OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
hydrolase /
cyclase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
protein /
hydrolase /
glycosidase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
DTO Classes protein /
Enzyme /
Lyase /
Cyclase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
