Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CA4

DescriptionCarbonic anhydrase 4

Gene and Protein Information

Gene ID762
Uniprot Accession IDs B4DQA4 Q6FHI7
Ensembl ID ENSP00000300900
Symbol CAIV Car4 RP17
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454807CA4carbonic anhydrase 49598VGNC:9136OMA, EggNOG
Mouse12351Car4carbonic anhydrase 410090MGI:1096574Inparanoid, OMA, EggNOG
Rat29242Car4carbonic anhydrase 410116RGD:2242OMA, EggNOG
Dog480591CA4carbonic anhydrase 49615VGNC:38612Inparanoid, OMA, EggNOG
Horse100071384CA4carbonic anhydrase 49796VGNC:15965Inparanoid, OMA, EggNOG
Cow280741CA4carbonic anhydrase 49913VGNC:26654Inparanoid, OMA, EggNOG
Pig100511956CA4carbonic anhydrase 49823Inparanoid, OMA, EggNOG
Chicken417647CA4carbonic anhydrase 49031CGNC:3991Inparanoid, OMA, EggNOG
Anole lizard103280438ca4carbonic anhydrase 428377Inparanoid, OMA, EggNOG
Xenopus100489625ca4carbonic anhydrase IV8364XB-GENE-5952677OMA, EggNOG
Zebrafish555196ca4acarbonic anhydrase IV a7955ZDB-GENE-080204-85OMA, EggNOG

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      Retinitis pigmentosa 171UniProt DiseaseMONDO:0010945
      retinitis pigmentosa130MonarchMONDO:0019200
      adult high grade glioma4998Expression AtlasMONDO:0100342
      astrocytic glioma3773Expression AtlasMONDO:0021636
      Astrocytoma, Pilocytic3186Expression AtlasMONDO:0016691
      colon cancer1587Expression AtlasMONDO:0021063
      ductal carcinoma in situ1737Expression AtlasMONDO:0005023
      gastric carcinoma1287Expression AtlasMONDO:0004950
      glioblastoma5998Expression AtlasMONDO:0018177
      group 3 medulloblastoma7142Expression AtlasMONDO:0007959

      Bibliography

      1.Wistrand, P J PJ, Carter, N D ND, Conroy, C W CW and Mahieu, I I. 1999-02 Carbonic anhydrase IV activity is localized on the exterior surface of human erythrocytes. [PMID:10090333]
      2.Fujikawa-Adachi, K K and 6 more authors. 1999-05 Identification of carbonic anhydrase IV and VI mRNA expression in human pancreas and salivary glands. [PMID:10231836]
      3.Sterling, Deborah D, Alvarez, Bernardo V BV and Casey, Joseph R JR. 2002-07-12 The extracellular component of a transport metabolon. Extracellular loop 4 of the human AE1 Cl-/HCO3- exchanger binds carbonic anhydrase IV. [PMID:11994299]
      4.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      5.Okuyama, T T, Sato, S S, Zhu, X L XL, Waheed, A A and Sly, W S WS. 1992-02-15 Human carbonic anhydrase IV: cDNA cloning, sequence comparison, and expression in COS cell membranes. [PMID:1311094]
      6.Alvarez, Bernardo V BV, Loiselle, Frederick B FB, Supuran, Claudiu T CT, Schwartz, George J GJ and Casey, Joseph R JR. 2003-10-28 Direct extracellular interaction between carbonic anhydrase IV and the human NBC1 sodium/bicarbonate co-transporter. [PMID:14567693]
      7.Rebello, George G and 12 more authors. 2004-04-27 Apoptosis-inducing signal sequence mutation in carbonic anhydrase IV identified in patients with the RP17 form of retinitis pigmentosa. [PMID:15090652]
      8.Pisitkun, Trairak T, Shen, Rong-Fong RF and Knepper, Mark A MA. 2004-09-07 Identification and proteomic profiling of exosomes in human urine. [PMID:15326289]
      9.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      10.Yang, Zhenglin Z and 17 more authors. 2005-01-15 Mutant carbonic anhydrase 4 impairs pH regulation and causes retinal photoreceptor degeneration. [PMID:15563508]