The store will not work correctly when cookies are disabled.
CA4
| Description | Carbonic anhydrase 4 |
|---|
Gene and Protein Information
| Gene ID | 762 |
|---|
| Uniprot Accession IDs | B4DQA4 Q6FHI7 |
|---|
| Ensembl ID | ENSP00000300900 |
|---|
| Symbol | CAIV Car4 RP17 |
|---|
| Family | Belongs to the alpha-carbonic anhydrase family. |
|---|
| Sequence | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454807 | CA4 | carbonic anhydrase 4 | 9598 | VGNC:9136 | OMA, EggNOG |
| Mouse | 12351 | Car4 | carbonic anhydrase 4 | 10090 | MGI:1096574 | Inparanoid, OMA, EggNOG |
| Rat | 29242 | Car4 | carbonic anhydrase 4 | 10116 | RGD:2242 | OMA, EggNOG |
| Dog | 480591 | CA4 | carbonic anhydrase 4 | 9615 | VGNC:38612 | Inparanoid, OMA, EggNOG |
| Horse | 100071384 | CA4 | carbonic anhydrase 4 | 9796 | VGNC:15965 | Inparanoid, OMA, EggNOG |
| Cow | 280741 | CA4 | carbonic anhydrase 4 | 9913 | VGNC:26654 | Inparanoid, OMA, EggNOG |
| Pig | 100511956 | CA4 | carbonic anhydrase 4 | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 417647 | CA4 | carbonic anhydrase 4 | 9031 | CGNC:3991 | Inparanoid, OMA, EggNOG |
| Anole lizard | 103280438 | ca4 | carbonic anhydrase 4 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100489625 | ca4 | carbonic anhydrase IV | 8364 | XB-GENE-5952677 | OMA, EggNOG |
| Zebrafish | 555196 | ca4a | carbonic anhydrase IV a | 7955 | ZDB-GENE-080204-85 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
