JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
CAMP

CAMP

Description	Cathelicidin antimicrobial peptide

Gene and Protein Information

Gene ID	820
Uniprot Accession IDs	Q71SN9
Ensembl ID	ENSP00000296435
Symbol	CAP18 FALL39 LL37 CAP18 CRAMP HSD26 CAP-18 FALL39 FALL-39
Family	Belongs to the cathelicidin family.
Sequence	MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	741881	CAMP	cathelicidin antimicrobial peptide	9598	VGNC:1751	Inparanoid, OMA
Macaque	619186	CAMP	cathelicidin antimicrobial peptide	9544		Inparanoid, OMA
Mouse	12796	Camp	cathelicidin antimicrobial peptide	10090	MGI:108443	Inparanoid, OMA
Rat	316010	Camp	cathelicidin antimicrobial peptide	10116	RGD:1559878	Inparanoid, OMA
Dog	442947	CAMP	cathelicidin antimicrobial peptide	9615	VGNC:38688	Inparanoid, OMA
Horse	100034135	ECATH-3	myeloid cathelicidin 3	9796		Inparanoid, OMA
Cow	282164	CATHL1	cathelicidin 1	9913		Inparanoid, OMA
Chicken	414337	CATH1	cathelicidin-1	9031	CGNC:49912	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]