The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cathelicidin antimicrobial peptide
| Gene ID | 820 |
|---|
| uniprot | P49913 |
|---|
| Gene Name | CAMP |
|---|
| Ensernbl ID | ENSP00000296435 |
|---|
| Family | Belongs to the cathelicidin family. |
|---|
| Sequence | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 820 | CAMP | Cathelicidin antimicrobial peptide | P49913 |
| MOUSE | | Camp | Uncharacterized protein | Q3TZ97 |
| MOUSE | 12796 | Camp | Cathelicidin antimicrobial peptide | P51437 |
| RAT | 316010 | Camp | Cathelicidin antimicrobial peptide | G3V8S9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
